Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : V4U7W7
dbSWEET id: dbswt_545
Accession: V4U7W7
Uniprot status: Unreviewed
Organism: Citrus clementina
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Sapindales ⇒ Rutaceae ⇒ Aurantioideae ⇒ Citrus.
Sequence Information back to top
Sequence length: 249
Substrate Binding Site: CNWS CVV: 418 CHI: -2.7
Selectivity Filter: LNMT CVV: 437 CHI: 1.5
Fasta sequence:
>tr|V4U7W7|V4U7W7_9ROSI|Unreviewed|Citrus_clementina|249
MGDGLRLAFGVMGNAASLLLYATPILTFSRVIKKKSTEGFSCFPYIIALLNCLLYTWYAL
PVVSYRWENFTVVTINGLGIFLELSFILIYFLFASARDKIKVAAIVIPVILLFCITALVS
AFVFHDHHHRKLFVGSIGLGASITMYSSPLVAVKQVIRTKSVEFMPFHLSFFSFLTSAIW
MVYGLLSHDLFIASPSFVGGPLGILQLVLYWKYRKSGIIKEPNKWDLEKNGENSKKLQLA
INNDINGKS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 215
Alignment file: V4U7W7.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V4U7W7_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.2% favored 2.6% allowed 2.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V4U7W7_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.6% favored 6.3% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V4U7W7_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.2% favored 5.8% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 18033041 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA