| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V4S7B3
dbSWEET id: dbswt_520
Accession: V4S7B3
Uniprot status: Unreviewed
Organism: Citrus clementina
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Sapindales ⇒ Rutaceae ⇒ Aurantioideae ⇒ Citrus.
Sequence Information back to top
Sequence length: 234
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: MNMN CVV: 440 CHI: -3.2
Fasta sequence:
>tr|V4S7B3|V4S7B3_9ROSI|Unreviewed|Citrus_clementina|234
MKDLSFYVGVIGSIISVLMFLAPVRTFWRIIKHRSTEEFQSLPYICTLLNSSLWTYYGIT
RPGSYLVATVNGFGILVEAVYVTLFFIYAPTKAMRAKTAIIFGILDVGFLGAAIAATRLA
LEGEARIDAIGFMCAGLNIIMYASPLSAMKTVVTTKSVEFMPFMLSFFFFLNGGIWAFYA
LLVRDIFLGVPNGTGFLLGTAQLVLYAIYRNAKPSKNAANSMEEGAQHEPLIIS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 211
Alignment file: V4S7B3.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V4S7B3_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 2.7% allowed 1.6% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V4S7B3_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.5% favored 4.4% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V4S7B3_occluded.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 4.4% allowed .5% week 1.1% disallowed
Gene Informationback to top
Gene ID: 18032835 Total Exons: 4 Coding Exons: 4
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA