Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : V4S7B3

dbSWEET id: dbswt_520

Accession:   V4S7B3

Uniprot status:   Unreviewed

Organism:   Citrus clementina

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Sapindales ⇒ Rutaceae ⇒ Aurantioideae ⇒ Citrus.

Sequence Information back to top


Sequence length:   234

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   MNMN           CVV:   440       CHI:   -3.2

Fasta sequence:

>tr|V4S7B3|V4S7B3_9ROSI|Unreviewed|Citrus_clementina|234
MKDLSFYVGVIGSIISVLMFLAPVRTFWRIIKHRSTEEFQSLPYICTLLNSSLWTYYGIT
RPGSYLVATVNGFGILVEAVYVTLFFIYAPTKAMRAKTAIIFGILDVGFLGAAIAATRLA
LEGEARIDAIGFMCAGLNIIMYASPLSAMKTVVTTKSVEFMPFMLSFFFFLNGGIWAFYA
LLVRDIFLGVPNGTGFLLGTAQLVLYAIYRNAKPSKNAANSMEEGAQHEPLIIS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: V4S7B3.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  V4S7B3_inward.pdb

Procheck score ⇒ Ramachandran plot: 94.5% favored    2.7% allowed    1.6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  V4S7B3_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.5% favored    4.4% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  V4S7B3_occluded.pdb

Procheck score ⇒ Ramachandran plot: 94.0% favored    4.4% allowed    .5% week    1.1% disallowed

Gene Informationback to top


Gene ID:   18032835     Total Exons:   4     Coding Exons:   4

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur