Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : V4M8E8
dbSWEET id: dbswt_239
Accession: V4M8E8
Uniprot status: Unreviewed
Organism: Eutrema salsugineum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Eutremeae ⇒ Eutrema.
Sequence Information back to top
Sequence length: 269
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVN CVV: 379 CHI: 4.1
Fasta sequence:
>tr|V4M8E8|V4M8E8_EUTSA|Unreviewed|Eutrema_salsugineum|269
MVFIKVHQLAFLFGLLGNIVSFGVFLSPVPTFYGIYKKKSSKGFQSIPYICALASATLLL
YYGIMKKHAYLIISINTFGCFIEISYLLIYIIYAPREAKIFTLKLIVICNIGGLGLLILL
VDLLVPKPNRVSTVGWVCAAYSLAVFASPLSVMRKVIRTKSVEYMPFLLSLSLTLNAVMW
FFYGLLIKDKFIAMPNILGFLFGIAQMILYMMYHSRKTDLANLTSTKTQPTNETNLNEVA
IVAVELPDARSDNVEGSARPVKTPNSSTA
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 215
Alignment file: V4M8E8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V4M8E8_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 5.9% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V4M8E8_outward.pdb
Procheck score ⇒ Ramachandran plot: 90.4% favored 8.6% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V4M8E8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.4% favored 7.5% allowed 1.1% week .0% disallowed
Gene Informationback to top
Gene ID: 18027249 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA