Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : V4M7D6

dbSWEET id: dbswt_505

Accession:   V4M7D6

Uniprot status:   Unreviewed

Organism:   Eutrema salsugineum

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Eutremeae ⇒ Eutrema.

Sequence Information back to top


Sequence length:   231

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   VSMN           CVV:   398       CHI:   1.8

Fasta sequence:

>tr|V4M7D6|V4M7D6_EUTSA|Unreviewed|Eutrema_salsugineum|231
MAELSFYIGVIGNVISVLVFLSPVETFWRIVKRRSTEEYECLPYICTLMSCSLWTYYGIV
TPGEYLVSTVNGFGALAESIYVLIFLFFVPKPRLLNTVLVVLALNVIFPVIAIVGTRTAF
GDAKMRSNSMGFICATLNIIMYGSPLSAIKTVVTTKSVKYMPFWLSFFLFLNGAIWGFYA
LLLHDVFLLVPNGMGFLLGTIQLLIYAFYRNAKPNVEDEEEVLTPSQPLLS

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   211

Alignment file: V4M7D6.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  V4M7D6_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    6.5% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  V4M7D6_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.1% favored    3.8% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  V4M7D6_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.3% favored    6.0% allowed    2.2% week    .5% disallowed

Gene Informationback to top


Gene ID:   18025123     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur