Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : V4LPG6
dbSWEET id: dbswt_32
Accession: V4LPG6
Uniprot status: Unreviewed
Organism: Eutrema salsugineum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Eutremeae ⇒ Eutrema.
Sequence Information back to top
Sequence length: 291
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|V4LPG6|V4LPG6_EUTSA|Unreviewed|Eutrema_salsugineum|291
MPLFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW
LYYATQKKDVFLLVTINAFGCFIETIYISMYLAYAPKTAKMLTVKLLLLMNFGGFCLILL
ICQFLFKGPTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVI
WLLYGLALKDFYVAFPNVIGFVLGALQMILYVVYKYCKTPPHLGEKEVEAAKLPEVSLDM
LKLGTISSPEPAPIAVVRQANKCTCGNDRRAEVEDEQNVKNGKQSSSGAAT
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 4 Model end: 216
Alignment file: V4LPG6.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V4LPG6_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 5.8% allowed 1.1% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V4LPG6_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 3.7% allowed 1.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V4LPG6_occluded.pdb
Procheck score ⇒ Ramachandran plot: 93.7% favored 4.8% allowed 1.6% week .0% disallowed
Gene Informationback to top
Gene ID: 18021538 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA