| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V4LN41
dbSWEET id: dbswt_96
Accession: V4LN41
Uniprot status: Unreviewed
Organism: Eutrema salsugineum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Eutremeae ⇒ Eutrema.
Sequence Information back to top
Sequence length: 297
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|V4LN41|V4LN41_EUTSA|Unreviewed|Eutrema_salsugineum|297
MGIMINHHLLAIVFGALGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW
LYYALIKQNAFLLITINSFGCVVETLYIAMFFAYATKDKRIAAMKLFITMNVAFFSLILM
VTHFVVKSPTLQVSVIGWVCVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAV
MWFAYGLFLHDICIAIPNVVGFILGMVQMVLYGVYRNSGEKLDIEKKVNTSDQQLKSIVV
MSPLGVSEVHPIDVKMTESVDPLPDAVHHHEEEPSKVTKEEEPSLEDGKCPRGDCPS
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 4 Model end: 217
Alignment file: V4LN41.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V4LN41_inward.pdb
Procheck score ⇒ Ramachandran plot: 93.4% favored 5.6% allowed .5% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V4LN41_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 5.1% allowed 2.0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V4LN41_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.9% favored 5.6% allowed 1.0% week .5% disallowed
Gene Informationback to top
Gene ID: 18016760 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA