| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V4LHI2
dbSWEET id: dbswt_569
Accession: V4LHI2
Uniprot status: Unreviewed
Organism: Eutrema salsugineum
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ rosids ⇒ malvids ⇒ Brassicales ⇒ Brassicaceae ⇒ Eutremeae ⇒ Eutrema.
Sequence Information back to top
Sequence length: 258
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMA CVV: 411 CHI: 4
Fasta sequence:
>tr|V4LHI2|V4LHI2_EUTSA|Unreviewed|Eutrema_salsugineum|258
MGDDKLRLSVGILGNGASLLLYTAPILTFSRVFKKKSTEEFSCFPYVMTLFNCLVYTWYG
LPIVSHLWENFPLVTINGVGILLESIFIFIYFCYASPKEKIKVGVVFVPVIVVFGLTTAI
SAVVFDDHRHRKSFVGSVGLVASVSMYGSPLVVMKKVIETKSVEYMPFYLSFFSFLASSL
WMAYGLLSHDLFLASPNMVGTPLGILQLILYFKYKNKREAPTTMVMGTWTDEKNKTTLNL
VVDIDDGDANVKNLNNAC
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 216
Alignment file: V4LHI2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V4LHI2_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.0% favored 6.4% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V4LHI2_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.1% favored 5.9% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V4LHI2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 86.7% favored 10.1% allowed .5% week 2.7% disallowed
Gene Informationback to top
Gene ID: 18017874 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA