| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : V4AV92
dbSWEET id: dbswt_1248
Accession: V4AV92
Uniprot status: Unreviewed
Organism: Lottia gigantea
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Lophotrochozoa ⇒ Mollusca ⇒ Gastropoda ⇒ Patellogastropoda ⇒ Lottioidea ⇒ Lottiidae ⇒ Lottia.
Sequence Information back to top
Sequence length: 213
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: MNLS CVV: 417 CHI: 1.4
Fasta sequence:
>tr|V4AV92|V4AV92_LOTGI|Unreviewed|Lottia_gigantea|213
MELMTAVEYWTTAVTFLMMASGLPPCYNMYKNKSTKNIPFIFFLISEMNSLFGACYGTLS
GNYIVFIINVVGFLLWGFYIIVYVFVSKTKVRSIGMVLIMMIVCGSHLKYVSTFTQHKEM
TSMLGQILFVWSIILLLTPALDIIAVIQQGTSEGMSVSLLIGCALSSLSWLLYGYMLKDL
YIYGPNIPGTVVNIGKFIALFCYKKPSKSLKSE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 205
Alignment file: V4AV92.pir
Inward Open:
Template: 5CTG.pdb
Model structure: V4AV92_inward.pdb
Procheck score ⇒ Ramachandran plot: 89.4% favored 10.0% allowed .0% week .6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: V4AV92_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.7% favored 7.2% allowed .6% week .6% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: V4AV92_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.9% favored 7.8% allowed 2.2% week 1.1% disallowed
Gene Informationback to top
Gene ID: 20237361 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA