Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U7SM37

dbSWEET id: dbswt_1949

Accession:   U7SM37

Uniprot status:   Unreviewed

Organism:   Fusobacterium nucleatum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Fusobacteria ⇒ Fusobacteriales ⇒ Fusobacteriaceae ⇒ Fusobacterium.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|U7SM37|U7SM37_FUSNU|Unreviewed|Fusobacterium nucleatum|85
MTEKQSKIFGYLGSTLSILMYVSYIPQIMGNLSGHKTSFVQPLVATINCTIWVIYGLFKK
NKDLPIIFANLPGIIFGLIATITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  U7SM37_inward.pdb    Alignment file: U7SM37_inw.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    6.2% allowed    2.3% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  U7SM37_outward.pdb    Alignment file: U7SM37_out.pir

Procheck score ⇒ Ramachandran plot: 85.9% favored    12.5% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  U7SM37_occluded.pdb    Alignment file: U7SM37_occ.pir

Procheck score ⇒ Ramachandran plot: 88.3% favored    8.6% allowed    3.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur