Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U6PS67

dbSWEET id: dbswt_1247

Accession:   U6PS67

Uniprot status:   Unreviewed

Organism:   Haemonchus contortus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Trichostrongyloidea ⇒ Haemonchidae ⇒ Haemonchinae ⇒ Haemonchus.

Sequence Information back to top


Sequence length:   228

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   FMSL           CVV:   456       CHI:   7.7

Fasta sequence:

>tr|U6PS67|U6PS67_HAECO|Unreviewed|Haemonchus_contortus|228
MTMELTPMSIFTAWLGVFSISFTLMPFTMVLDWRRRGTADGFSSVNFVLPMLMTSCWLRH
GYMTNDNTNITINTINIAFFIFYIAAFAYYQPKRKYLYGQLLSCAAVVKLVFMYVDMQKS
DVAPDVMGSIAAAMQIASLAGGIYEIKRAISFGHTEYLPASFQYAMFLLIIQWLAFGLLT
GNQYIAIANAAALIVNVVTISLYFIYPPLTWRVPIIGTGPQLKDKKKE

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   208

Alignment file: U6PS67.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  U6PS67_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.6% favored    4.8% allowed    1.6% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  U6PS67_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.7% favored    5.3% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  U6PS67_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.0% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur