Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U6PKL1

dbSWEET id: dbswt_1246

Accession:   U6PKL1

Uniprot status:   Unreviewed

Organism:   Haemonchus contortus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Trichostrongyloidea ⇒ Haemonchidae ⇒ Haemonchinae ⇒ Haemonchus.

Sequence Information back to top


Sequence length:   259

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LSSV           CVV:   375       CHI:   6.4

Fasta sequence:

>tr|U6PKL1|U6PKL1_HAECO|Unreviewed|Haemonchus_contortus|259
MNQSDPNMTSSSPMSRLYWSTIDKIRSQMTIADEILPYLSVSAICTTIGLFLCGIQICLR
IRERGTTEGTGSAPFLIAFISCAFWLQYGVLKHDNVVIFVNIVGFMLQGCYLSYYFFMTR
NTRLLRKVIGLEFIAIGLMLYAVNYGGFKDNGRETLGAICVILNIASIGAPLFQIGEVIR
TKNSESLPLPLCLACFAVSLQWLLYGLLVHDIVIQVPNYIATLLSVIQLSLFVIYPRRPT
FIEMEDPLYTVNKRINHDM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   29     Model end:   237

Alignment file: U6PKL1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  U6PKL1_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    3.8% allowed    1.1% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  U6PKL1_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.1% favored    4.4% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  U6PKL1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    6.0% allowed    2.2% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur