Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U6P8G1

dbSWEET id: dbswt_1245

Accession:   U6P8G1

Uniprot status:   Unreviewed

Organism:   Haemonchus contortus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Trichostrongyloidea ⇒ Haemonchidae ⇒ Haemonchinae ⇒ Haemonchus.

Sequence Information back to top


Sequence length:   297

Substrate Binding Site:   GNWN           CVV:   403       CHI:   -8.3

Selectivity Filter:   LGNV           CVV:   373       CHI:   4.1

Fasta sequence:

>tr|U6P8G1|U6P8G1_HAECO|Unreviewed|Haemonchus_contortus|297
MDLKTFLQLLSCSAIVTTICLFLCGIPICIEILRRRTTQEISGVPFLMGLLGGAFWLRYG
FLKDDSVMIIVNVVCISLFTVYCIFYLIFANNRCSFLTKLSFVLSIIGAMCAWIAYNPNI
NYLGIACMTFNILNFGAPLAGLGVVLRKRCCDSLPLPMCVTNLLVSSQWFLYGNIVQDKY
IMAPNGIGMALAVFQLSLFLIFPRKENGKSMVSQVADFFTSVPAETEVDHEKGDRISTLT
TSTGISIASGQTLMRKLSEALDRKTGRSGSFGAVIAELQQTRPRTTSEPEISKFKKV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   204

Alignment file: U6P8G1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  U6P8G1_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.3% favored    8.9% allowed    .6% week    2.2% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  U6P8G1_outward.pdb

Procheck score ⇒ Ramachandran plot: 90.6% favored    7.8% allowed    1.1% week    .6% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  U6P8G1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.0% favored    7.2% allowed    1.7% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur