Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U6P4X4

dbSWEET id: dbswt_1244

Accession:   U6P4X4

Uniprot status:   Unreviewed

Organism:   Haemonchus contortus

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Trichostrongyloidea ⇒ Haemonchidae ⇒ Haemonchinae ⇒ Haemonchus.

Sequence Information back to top


Sequence length:   261

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LSSV           CVV:   375       CHI:   6.4

Fasta sequence:

>tr|U6P4X4|U6P4X4_HAECO|Unreviewed|Haemonchus_contortus|261
MNQSDPNMTSSAPMSRLYWSTIDKIRSQMTLADEILPYLSVSAICTTIGLFLCGIQICLR
IRERGTTEGTGSAPFLIAFISCAFWLQYGVLKHDNVVIFVNIVGFMLQGCYLSYYFFMTR
NTRLLRKVIGLEFIAIGLMLYAVNYGGFKDNDNGRETLGAICVILNIASIGAPLFQIGEV
IRTKNSESLPLPLCLACFAVSLQWLLYGLLVHDIVIQVPNYIATLLSVIQLSLFVIYPRR
PTFIEMEDPLYTVNKRINHDM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   29     Model end:   239

Alignment file: U6P4X4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  U6P4X4_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.4% favored    6.5% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  U6P4X4_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.5% favored    5.9% allowed    .0% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  U6P4X4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.9% allowed    1.1% week    1.1% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur