Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : U6NKN8
dbSWEET id: dbswt_1243
Accession: U6NKN8
Uniprot status: Unreviewed
Organism: Haemonchus contortus
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Rhabditida ⇒ Strongylida ⇒ Trichostrongyloidea ⇒ Haemonchidae ⇒ Haemonchinae ⇒ Haemonchus.
Sequence Information back to top
Sequence length: 226
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: FMSL CVV: 456 CHI: 7.7
Fasta sequence:
>tr|U6NKN8|U6NKN8_HAECO|Unreviewed|Haemonchus_contortus|226
MELTPMSIFTAWLGVFSISFTLMPFTMVLDWRRRGTADGFSSVNFVLPMLMTSCWLRHGY
MTNDNTNITINTINIAFFIFYIAAFAYYQPKRKYLYGQLLACAAVVKLVFMYVDMQKSDV
APDVMGSIAAAMQIASLAGGIYEIKRAISFGHTEYLPASFQYAMFLLIIQWLAFGLLTGN
QYIAIANAAALIVNVVTISLYFIYPPLTWRVPIIGTGPQLKEKKKE
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 206
Alignment file: U6NKN8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: U6NKN8_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.9% favored 7.5% allowed .5% week 1.1% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: U6NKN8_outward.pdb
Procheck score ⇒ Ramachandran plot: 93.0% favored 7.0% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: U6NKN8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 90.3% favored 7.0% allowed 1.1% week 1.6% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA