| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U5P751
dbSWEET id: dbswt_1947
Accession: U5P751
Uniprot status: Unreviewed
Organism: Streptococcus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 91
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|U5P751|U5P751_9STRE|Unreviewed|Streptococcus|91
MKGILKMNEKQMKILGWVATFMSVMMYVSYFPQIMDNLAGHKGNFIQPLVAAINCSLWVY
YGLFKKERDIPLAAANAPGIIFGLITAITAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 16 Model end: 92 Inward Open: Template: 4X5M.pdb Model structure: U5P751_inward.pdb Alignment file: U5P751_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 8.5% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: U5P751_outward.pdb Alignment file: U5P751_out.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 4.6% allowed .0% week 1.5% disallowed Occluded: Model structure: U5P751_occluded.pdb Alignment file: U5P751_occ.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 6.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA