Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U5P751

dbSWEET id: dbswt_1947

Accession:   U5P751

Uniprot status:   Unreviewed

Organism:   Streptococcus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.

Sequence Information back to top


Sequence length:   91

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|U5P751|U5P751_9STRE|Unreviewed|Streptococcus|91
MKGILKMNEKQMKILGWVATFMSVMMYVSYFPQIMDNLAGHKGNFIQPLVAAINCSLWVY
YGLFKKERDIPLAAANAPGIIFGLITAITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   16     Model end:   92

Inward Open:

Template:   4X5M.pdb

Model structure:  U5P751_inward.pdb    Alignment file: U5P751_inw.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    8.5% allowed    .8% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  U5P751_outward.pdb    Alignment file: U5P751_out.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    4.6% allowed    .0% week    1.5% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  U5P751_occluded.pdb    Alignment file: U5P751_occ.pir

Procheck score ⇒ Ramachandran plot: 93.8% favored    6.2% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur