| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U5EYM8
dbSWEET id: dbswt_1242
Accession: U5EYM8
Uniprot status: Unreviewed
Organism: Corethrella appendiculata
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Chaoboridae ⇒ Corethrella.
Sequence Information back to top
Sequence length: 229
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: QSFV CVV: 427 CHI: 2.7
Fasta sequence:
>tr|U5EYM8|U5EYM8_9DIPT|Unreviewed|Corethrella_appendiculata|229
LKMFFDLSFKDILATSSTVSTVLQFLTGSLVCKKYFQKKSTGESSGFPFVAGFLSTSLWL
KYGLLTDEHTLILVNLIGSILFLSYVTIFYIFTVNKRHIVRQFLIVLIIIFLAIIYAKYE
IDRKKSVELIGLLCCTVGVVFFASPLIMLVHVIKVKNSESLPFPLIFSSFLVCIQWWIYG
ILIDDAFIQIPNLLGAVLSGAQLLLFIIYPSKNTYSSGQLYQQLQTEIS
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 3 Model end: 211
Alignment file: U5EYM8.pir
Inward Open:
Template: 5CTG.pdb
Model structure: U5EYM8_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.5% favored 6.3% allowed 1.6% week 1.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: U5EYM8_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.7% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: U5EYM8_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.6% favored 6.8% allowed .5% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA