Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U5ESX2

dbSWEET id: dbswt_1241

Accession:   U5ESX2

Uniprot status:   Unreviewed

Organism:   Corethrella appendiculata

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Chaoboridae ⇒ Corethrella.

Sequence Information back to top


Sequence length:   227

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   QFLV           CVV:   478       CHI:   7.3

Fasta sequence:

>tr|U5ESX2|U5ESX2_9DIPT|Unreviewed|Corethrella_appendiculata|227
LTSLGNLLHPHRDLIGLSAAAITIIQFLSGFLVINGIRKKGNTEGFAVFPFLIGGVFCLL
NIYFGQMIQDPAMIKVNLIGFALNIIYVTLFYIYSIGSTKSKVWLQTGISGAFAFGIISY
AQYEDPKLVEFRFGIILTLILFVLLGSPLAELGDIIKRKSTEGLPFPMILCGTLVSFAWF
LYGIAIFNDFIIVQNVIALVLCGIQLSLFVIYPSTAAVKVQKNKKEN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   214

Alignment file: U5ESX2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  U5ESX2_inward.pdb

Procheck score ⇒ Ramachandran plot: 87.2% favored    10.6% allowed    1.1% week    1.1% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  U5ESX2_outward.pdb

Procheck score ⇒ Ramachandran plot: 93.9% favored    5.0% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  U5ESX2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.6% favored    8.3% allowed    1.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur