Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U5ESW2

dbSWEET id: dbswt_1240

Accession:   U5ESW2

Uniprot status:   Unreviewed

Organism:   Corethrella appendiculata

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Chaoboridae ⇒ Corethrella.

Sequence Information back to top


Sequence length:   230

Substrate Binding Site:   SNWN           CVV:   399       CHI:   -3.4

Selectivity Filter:   QLLV           CVV:   467       CHI:   8.3

Fasta sequence:

>tr|U5ESW2|U5ESW2_9DIPT|Unreviewed|Corethrella_appendiculata|230
METFTEILAPHKEIIASVAGTLTVGQMFSGAFVCNDIRKKGSTKDFSVMPFLGGIILSIL
FMKHALLLNAPEMLIPNLAGIGLSLIYTAFYYLYTPHGEGKSEFWKTSVKGIIFIGVLLA
YAEFENAEVVEYRFGMFITFLLIGLIAMPLFSLGEIRRKKSTEGLPFAMILSGTGVSFSW
LLYGFSIASEVVVIQNLIAFILSAIQLSLFVIYPSTPSAIKTAKKSKKSN

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   215

Alignment file: U5ESW2.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  U5ESW2_inward.pdb

Procheck score ⇒ Ramachandran plot: 86.8% favored    8.2% allowed    1.1% week    3.8% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  U5ESW2_outward.pdb

Procheck score ⇒ Ramachandran plot: 91.8% favored    7.1% allowed    .5% week    .5% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  U5ESW2_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.2% favored    8.8% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur