Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : U5ESW2
dbSWEET id: dbswt_1240
Accession: U5ESW2
Uniprot status: Unreviewed
Organism: Corethrella appendiculata
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Diptera ⇒ Nematocera ⇒ Culicoidea ⇒ Chaoboridae ⇒ Corethrella.
Sequence Information back to top
Sequence length: 230
Substrate Binding Site: SNWN CVV: 399 CHI: -3.4
Selectivity Filter: QLLV CVV: 467 CHI: 8.3
Fasta sequence:
>tr|U5ESW2|U5ESW2_9DIPT|Unreviewed|Corethrella_appendiculata|230
METFTEILAPHKEIIASVAGTLTVGQMFSGAFVCNDIRKKGSTKDFSVMPFLGGIILSIL
FMKHALLLNAPEMLIPNLAGIGLSLIYTAFYYLYTPHGEGKSEFWKTSVKGIIFIGVLLA
YAEFENAEVVEYRFGMFITFLLIGLIAMPLFSLGEIRRKKSTEGLPFAMILSGTGVSFSW
LLYGFSIASEVVVIQNLIAFILSAIQLSLFVIYPSTPSAIKTAKKSKKSN
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 215
Alignment file: U5ESW2.pir
Inward Open:
Template: 5CTG.pdb
Model structure: U5ESW2_inward.pdb
Procheck score ⇒ Ramachandran plot: 86.8% favored 8.2% allowed 1.1% week 3.8% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: U5ESW2_outward.pdb
Procheck score ⇒ Ramachandran plot: 91.8% favored 7.1% allowed .5% week .5% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: U5ESW2_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.2% favored 8.8% allowed .0% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5