Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U5DEL5

dbSWEET id: dbswt_758

Accession:   U5DEL5

Uniprot status:   Unreviewed

Organism:   Amborella trichopoda

Kingdom:   Plantae

Taxonomy back to top


Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ basal Magnoliophyta ⇒ Amborellales ⇒ Amborellaceae ⇒ Amborella.

Sequence Information back to top


Sequence length:   251

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNMC           CVV:   430       CHI:   4.7

Fasta sequence:

>tr|U5DEL5|U5DEL5_AMBTC|Unreviewed|Amborella_trichopoda|251
MELAHFLFGIFGNATALFLFLAPVITFRRIIGSKSTEDFSGVPYVSTLLNCLLAAWYGLP
FVSPHNILVSTINGAGATIEFVFVTIFLIYANQKKVRVKIFGLLCIALSVFALVVLISLF
ALHGQSRKLFCGLAATIFSICMYASPLSVMRMVIRTKSVEFMPFFLSLFVFLCGTSWFIY
GLIGRDPFIYTPNGFGCALGTIQLILYAIYRKRGPMEGEGEGKGKEGEALEMGYAKSVDG
QQNHDATKVSA

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   212

Alignment file: U5DEL5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  U5DEL5_inward.pdb

Procheck score ⇒ Summary not found

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  U5DEL5_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.1% favored    4.3% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  U5DEL5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.9% favored    7.0% allowed    .5% week    .5% disallowed

Gene Informationback to top


Gene ID:   18448266     Total Exons:   5     Coding Exons:   5

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0005783 - endoplasmic reticulum

GO:0005887 - integral component of plasma membrane

GO:0051119 - sugar transmembrane transporter activity

Family Classificationback to top


Pfam:   PF03083: MtN3_slv. 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur