| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U5DEL5
dbSWEET id: dbswt_758
Accession: U5DEL5
Uniprot status: Unreviewed
Organism: Amborella trichopoda
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ basal Magnoliophyta ⇒ Amborellales ⇒ Amborellaceae ⇒ Amborella.
Sequence Information back to top
Sequence length: 251
Substrate Binding Site: CNWN CVV: 441 CHI: -5.4
Selectivity Filter: LNMC CVV: 430 CHI: 4.7
Fasta sequence:
>tr|U5DEL5|U5DEL5_AMBTC|Unreviewed|Amborella_trichopoda|251
MELAHFLFGIFGNATALFLFLAPVITFRRIIGSKSTEDFSGVPYVSTLLNCLLAAWYGLP
FVSPHNILVSTINGAGATIEFVFVTIFLIYANQKKVRVKIFGLLCIALSVFALVVLISLF
ALHGQSRKLFCGLAATIFSICMYASPLSVMRMVIRTKSVEFMPFFLSLFVFLCGTSWFIY
GLIGRDPFIYTPNGFGCALGTIQLILYAIYRKRGPMEGEGEGKGKEGEALEMGYAKSVDG
QQNHDATKVSA
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 212
Alignment file: U5DEL5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: U5DEL5_inward.pdb
Procheck score ⇒ Summary not found
Outward Open:
Template: 5CTG_outward.pdb
Model structure: U5DEL5_outward.pdb
Procheck score ⇒ Ramachandran plot: 95.1% favored 4.3% allowed .5% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: U5DEL5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 91.9% favored 7.0% allowed .5% week .5% disallowed
Gene Informationback to top
Gene ID: 18448266 Total Exons: 5 Coding Exons: 5
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number





Gene Ontologyback to top
GO:0005783 - endoplasmic reticulum
GO:0005887 - integral component of plasma membrane
GO:0051119 - sugar transmembrane transporter activity
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA