| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U2YAR6
dbSWEET id: dbswt_1944
Accession: U2YAR6
Uniprot status: Unreviewed
Organism: Streptococcus constellatus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus ⇒ Streptococcus anginosus group.
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|U2YAR6|U2YAR6_STRCV|Unreviewed|Streptococcus constellatus|88
MEMSEKRMKMIGWVATFMSVMMYVSYIPQIMDNLAGHKGNFIQPLVAAINCSLWVYYGLF
KKERDLPLAAANAPGIVFGLITVLTAMF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: U2YAR6_inward.pdb Alignment file: U2YAR6_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 4.6% allowed 3.8% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2YAR6_outward.pdb Alignment file: U2YAR6_out.pir Procheck score ⇒ Ramachandran plot: 94.6% favored 5.4% allowed .0% week .0% disallowed Occluded: Model structure: U2YAR6_occluded.pdb Alignment file: U2YAR6_occ.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 3.8% allowed 3.1% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA