Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U2YAR6

dbSWEET id: dbswt_1944

Accession:   U2YAR6

Uniprot status:   Unreviewed

Organism:   Streptococcus constellatus

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus ⇒ Streptococcus anginosus group.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|U2YAR6|U2YAR6_STRCV|Unreviewed|Streptococcus constellatus|88
MEMSEKRMKMIGWVATFMSVMMYVSYIPQIMDNLAGHKGNFIQPLVAAINCSLWVYYGLF
KKERDLPLAAANAPGIVFGLITVLTAMF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  U2YAR6_inward.pdb    Alignment file: U2YAR6_inw.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    4.6% allowed    3.8% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  U2YAR6_outward.pdb    Alignment file: U2YAR6_out.pir

Procheck score ⇒ Ramachandran plot: 94.6% favored    5.4% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  U2YAR6_occluded.pdb    Alignment file: U2YAR6_occ.pir

Procheck score ⇒ Ramachandran plot: 93.1% favored    3.8% allowed    3.1% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur