| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U2TV29
dbSWEET id: dbswt_1942
Accession: U2TV29
Uniprot status: Unreviewed
Organism: Olsenella profusa
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Actinobacteria ⇒ Coriobacteriia ⇒ Coriobacteriales ⇒ Atopobiaceae ⇒ Olsenella.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ANAN CVV: 326 CHI: -3.4
Fasta sequence:
>tr|U2TV29|U2TV29_9ACTN|Unreviewed|Olsenella profusa|85
MNQKTFKTVGWIATCTAMLMYIAYFPQIINNLHGDKSGFLQPMVAAINCTLWVCYGFFQK
KKDWPIMVANAPGVLFGAIAAITAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: U2TV29_inward.pdb Alignment file: U2TV29_inw.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 8.5% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2TV29_outward.pdb Alignment file: U2TV29_out.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 10.0% allowed .8% week .0% disallowed Occluded: Model structure: U2TV29_occluded.pdb Alignment file: U2TV29_occ.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 7.7% allowed 1.5% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA