Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U2TV29

dbSWEET id: dbswt_1942

Accession:   U2TV29

Uniprot status:   Unreviewed

Organism:   Olsenella profusa

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Actinobacteria ⇒ Coriobacteriia ⇒ Coriobacteriales ⇒ Atopobiaceae ⇒ Olsenella.

Sequence Information back to top


Sequence length:   85

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ANAN           CVV:   326       CHI:   -3.4

Fasta sequence:

>tr|U2TV29|U2TV29_9ACTN|Unreviewed|Olsenella profusa|85
MNQKTFKTVGWIATCTAMLMYIAYFPQIINNLHGDKSGFLQPMVAAINCTLWVCYGFFQK
KKDWPIMVANAPGVLFGAIAAITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   10     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  U2TV29_inward.pdb    Alignment file: U2TV29_inw.pir

Procheck score ⇒ Ramachandran plot: 91.5% favored    8.5% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  U2TV29_outward.pdb    Alignment file: U2TV29_out.pir

Procheck score ⇒ Ramachandran plot: 89.2% favored    10.0% allowed    .8% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  U2TV29_occluded.pdb    Alignment file: U2TV29_occ.pir

Procheck score ⇒ Ramachandran plot: 90.8% favored    7.7% allowed    1.5% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur