| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U2SYM7
dbSWEET id: dbswt_1941
Accession: U2SYM7
Uniprot status: Unreviewed
Organism: Leptotrichia
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|U2SYM7|U2SYM7_9FUSO|Unreviewed|Leptotrichia|88
MSKMSKINKIVGSIGAFIGVFVFIAYIPQIMANLSGTKSQPWQPLFASFSCLIWVIYGWT
KEPKKDYILIIPNVTGVILGFLTFITSF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 89 Inward Open: Template: 4X5M.pdb Model structure: U2SYM7_inward.pdb Alignment file: U2SYM7_inw.pir Procheck score ⇒ Ramachandran plot: 91.4% favored 5.5% allowed 2.3% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2SYM7_outward.pdb Alignment file: U2SYM7_out.pir Procheck score ⇒ Ramachandran plot: 93.0% favored 4.7% allowed 1.6% week .8% disallowed Occluded: Model structure: U2SYM7_occluded.pdb Alignment file: U2SYM7_occ.pir Procheck score ⇒ Ramachandran plot: 89.1% favored 7.0% allowed 2.3% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA