Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U2SYM7

dbSWEET id: dbswt_1941

Accession:   U2SYM7

Uniprot status:   Unreviewed

Organism:   Leptotrichia

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Fusobacteria ⇒ Fusobacteriales ⇒ Leptotrichiaceae ⇒ Leptotrichia.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   ASAS           CVV:   280       CHI:   2

Fasta sequence:

>tr|U2SYM7|U2SYM7_9FUSO|Unreviewed|Leptotrichia|88
MSKMSKINKIVGSIGAFIGVFVFIAYIPQIMANLSGTKSQPWQPLFASFSCLIWVIYGWT
KEPKKDYILIIPNVTGVILGFLTFITSF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   89

Inward Open:

Template:   4X5M.pdb

Model structure:  U2SYM7_inward.pdb    Alignment file: U2SYM7_inw.pir

Procheck score ⇒ Ramachandran plot: 91.4% favored    5.5% allowed    2.3% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  U2SYM7_outward.pdb    Alignment file: U2SYM7_out.pir

Procheck score ⇒ Ramachandran plot: 93.0% favored    4.7% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  U2SYM7_occluded.pdb    Alignment file: U2SYM7_occ.pir

Procheck score ⇒ Ramachandran plot: 89.1% favored    7.0% allowed    2.3% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur