| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U2QF08
dbSWEET id: dbswt_1938
Accession: U2QF08
Uniprot status: Unreviewed
Organism: Prevotella baroniae
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|U2QF08|U2QF08_9BACT|Unreviewed|Prevotella baroniae|87
MMTKERFFTTLGWIGMVTSVLMYVFYIPQIENNLSGQKGTFIQPFMAAVNCTLWVGYGLF
KEKRDWPLAIANTPGIIFGLMAAFTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 12 Model end: 88 Inward Open: Template: 4X5M.pdb Model structure: U2QF08_inward.pdb Alignment file: U2QF08_inw.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 7.9% allowed 4.0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2QF08_outward.pdb Alignment file: U2QF08_out.pir Procheck score ⇒ Ramachandran plot: 84.9% favored 12.7% allowed .8% week 1.6% disallowed Occluded: Model structure: U2QF08_occluded.pdb Alignment file: U2QF08_occ.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 9.5% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA