Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U2QF08

dbSWEET id: dbswt_1938

Accession:   U2QF08

Uniprot status:   Unreviewed

Organism:   Prevotella baroniae

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   FNFN           CVV:   462       CHI:   -1.4

Fasta sequence:

>tr|U2QF08|U2QF08_9BACT|Unreviewed|Prevotella baroniae|87
MMTKERFFTTLGWIGMVTSVLMYVFYIPQIENNLSGQKGTFIQPFMAAVNCTLWVGYGLF
KEKRDWPLAIANTPGIIFGLMAAFTAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   12     Model end:   88

Inward Open:

Template:   4X5M.pdb

Model structure:  U2QF08_inward.pdb    Alignment file: U2QF08_inw.pir

Procheck score ⇒ Ramachandran plot: 87.3% favored    7.9% allowed    4.0% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  U2QF08_outward.pdb    Alignment file: U2QF08_out.pir

Procheck score ⇒ Ramachandran plot: 84.9% favored    12.7% allowed    .8% week    1.6% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  U2QF08_occluded.pdb    Alignment file: U2QF08_occ.pir

Procheck score ⇒ Ramachandran plot: 89.7% favored    9.5% allowed    .8% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur