| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U2MNC3
dbSWEET id: dbswt_1935
Accession: U2MNC3
Uniprot status: Unreviewed
Organism: Prevotella pleuritidis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|U2MNC3|U2MNC3_9BACT|Unreviewed|Prevotella pleuritidis|86
MEKSKFFERIGWVGMVTSILMYVFYFRVIQQNLSGHPGDPLQPLMAGINCTLWVCYGLFK
EKRDWPITIANAPGVVFGFIAAYTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: U2MNC3_inward.pdb Alignment file: U2MNC3_inw.pir Procheck score ⇒ Ramachandran plot: 86.3% favored 10.5% allowed .8% week 2.4% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2MNC3_outward.pdb Alignment file: U2MNC3_out.pir Procheck score ⇒ Ramachandran plot: 87.1% favored 11.3% allowed .0% week 1.6% disallowed Occluded: Model structure: U2MNC3_occluded.pdb Alignment file: U2MNC3_occ.pir Procheck score ⇒ Ramachandran plot: 91.9% favored 8.1% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA