Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U2LU35

dbSWEET id: dbswt_2006

Accession:   U2LU35

Uniprot status:   Unreviewed

Organism:   Selenomonas

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Firmicutes ⇒ Negativicutes ⇒ Selenomonadales ⇒ Selenomonadaceae ⇒ Selenomonas.

Sequence Information back to top


Sequence length:   119

Substrate Binding Site:   CACA           CVV:   306       CHI:   8.6

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|U2LU35|U2LU35_9FIRM|Unreviewed|Selenomonas| 119
MIFLEGTQYGRSIKKTEAEVEHLEEKAVQIGEESAKNKMSIVGVIASGLSICMYVSYIPQ
ILGNLSGHPGDWIQPFVAFINCTMWVGYGFFKKQRDWPLVIANSPGIIFGLTAAITARL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   43     Model end:   119

Inward Open:

Template:   4X5M.pdb

Model structure:  U2LU35_inward.pdb    Alignment file: U2LU35_inw.pir

Procheck score ⇒ Ramachandran plot: 86.9% favored    12.3% allowed    .0% week    .8% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  U2LU35_outward.pdb    Alignment file: U2LU35_out.pir

Procheck score ⇒ Ramachandran plot: 93.4% favored    6.6% allowed    .0% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  U2LU35_occluded.pdb    Alignment file: U2LU35_occ.pir

Procheck score ⇒ Ramachandran plot: 89.3% favored    9.0% allowed    .0% week    1.6% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur