| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U2JKK7
dbSWEET id: dbswt_1933
Accession: U2JKK7
Uniprot status: Unreviewed
Organism: Peptostreptococcaceae bacterium
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|U2JKK7|U2JKK7_9FIRM|Unreviewed|Peptostreptococcaceae bacterium|85
MNQKTLKIMGWIATCTAMLMYISYFPQIINNIHGAKSGFLQPMVAAINCTLWVSYGFFQE
KKDWPIVVANLPGVIFGAIAAITAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: U2JKK7_inward.pdb Alignment file: U2JKK7_inw.pir Procheck score ⇒ Ramachandran plot: 88.5% favored 10.0% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2JKK7_outward.pdb Alignment file: U2JKK7_out.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 8.5% allowed .0% week .0% disallowed Occluded: Model structure: U2JKK7_occluded.pdb Alignment file: U2JKK7_occ.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 10.0% allowed .0% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA