Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U2IYB1

dbSWEET id: dbswt_1932

Accession:   U2IYB1

Uniprot status:   Unreviewed

Organism:   Porphyromonas

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Porphyromonadaceae ⇒ Porphyromonas.

Sequence Information back to top


Sequence length:   87

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|U2IYB1|U2IYB1_9PORP|Unreviewed|Porphyromonas|87
MTKSKFLTILGTVASVTAILMYVSYISTIQGNLNGHKGDWIQPLVAAVNCTLWVFYGFLQ
PKKDWPIVVANAPGIVFGLAAALTALM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  U2IYB1_inward.pdb    Alignment file: U2IYB1_inw.pir

Procheck score ⇒ Ramachandran plot: 95.3% favored    4.7% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  U2IYB1_outward.pdb    Alignment file: U2IYB1_out.pir

Procheck score ⇒ Ramachandran plot: 89.8% favored    7.8% allowed    1.6% week    .8% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  U2IYB1_occluded.pdb    Alignment file: U2IYB1_occ.pir

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.1% allowed    1.6% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur