Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : U2IYB1
dbSWEET id: dbswt_1932
Accession: U2IYB1
Uniprot status: Unreviewed
Organism: Porphyromonas
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Porphyromonadaceae ⇒ Porphyromonas.
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|U2IYB1|U2IYB1_9PORP|Unreviewed|Porphyromonas|87
MTKSKFLTILGTVASVTAILMYVSYISTIQGNLNGHKGDWIQPLVAAVNCTLWVFYGFLQ
PKKDWPIVVANAPGIVFGLAAALTALM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: U2IYB1_inward.pdb Alignment file: U2IYB1_inw.pir Procheck score ⇒ Ramachandran plot: 95.3% favored 4.7% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2IYB1_outward.pdb Alignment file: U2IYB1_out.pir Procheck score ⇒ Ramachandran plot: 89.8% favored 7.8% allowed 1.6% week .8% disallowed Occluded: Model structure: U2IYB1_occluded.pdb Alignment file: U2IYB1_occ.pir Procheck score ⇒ Ramachandran plot: 95.3% favored 3.1% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA