| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U2INU5
dbSWEET id: dbswt_1931
Accession: U2INU5
Uniprot status: Unreviewed
Organism: Prevotella
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Bacteroidia ⇒ Bacteroidales ⇒ Prevotellaceae ⇒ Prevotella.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: FNFN CVV: 462 CHI: -1.4
Fasta sequence:
>tr|U2INU5|U2INU5_9BACT|Unreviewed|Prevotella|86
MTKEKFFTSMGWVGMVTSVLMYVFYFPQIENNLAGHKGTFIQPFMAGVNCTLWVAYGLFK
EKRDWPLAIANTPGIIFGFVAAFTAL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 11 Model end: 87 Inward Open: Template: 4X5M.pdb Model structure: U2INU5_inward.pdb Alignment file: U2INU5_inw.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 6.3% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2INU5_outward.pdb Alignment file: U2INU5_out.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 6.3% allowed .0% week .0% disallowed Occluded: Model structure: U2INU5_occluded.pdb Alignment file: U2INU5_occ.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.1% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA