| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U2FKG7
dbSWEET id: dbswt_1930
Accession: U2FKG7
Uniprot status: Unreviewed
Organism: Campylobacter concisus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Epsilonproteobacteria ⇒ Campylobacterales ⇒ Campylobacteraceae ⇒ Campylobacter.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|U2FKG7|U2FKG7_9PROT|Unreviewed|Campylobacter concisus|85
MSERNLQILGWIGTCLSVIMYFSYIPQIMGNLDGHKTPFIQPLAAAINCTIWTSYGLLKA
KKDYPLSAANLPGIIFGLLATITAF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: U2FKG7_inward.pdb Alignment file: U2FKG7_inw.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 6.3% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2FKG7_outward.pdb Alignment file: U2FKG7_out.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 7.1% allowed 2.4% week .8% disallowed Occluded: Model structure: U2FKG7_occluded.pdb Alignment file: U2FKG7_occ.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 10.3% allowed 2.4% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA