| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : U2F3C8
dbSWEET id: dbswt_1928
Accession: U2F3C8
Uniprot status: Unreviewed
Organism: Campylobacter concisus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Proteobacteria ⇒ Epsilonproteobacteria ⇒ Campylobacterales ⇒ Campylobacteraceae ⇒ Campylobacter.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|U2F3C8|U2F3C8_9PROT|Unreviewed|Campylobacter concisus|85
MSERNLQILGWIGTCLSVVMYFSYIPQIMGNLDGNKTPYIQPLAAALNCTIWTSYGLLKA
KKDYPLSAANLPGIIFGLLATITAF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: U2F3C8_inward.pdb Alignment file: U2F3C8_inw.pir Procheck score ⇒ Ramachandran plot: 93.7% favored 5.6% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: U2F3C8_outward.pdb Alignment file: U2F3C8_out.pir Procheck score ⇒ Ramachandran plot: 89.7% favored 8.7% allowed 1.6% week .0% disallowed Occluded: Model structure: U2F3C8_occluded.pdb Alignment file: U2F3C8_occ.pir Procheck score ⇒ Ramachandran plot: 87.3% favored 11.9% allowed .8% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA