Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : U1R6T0
dbSWEET id: dbswt_1925
Accession: U1R6T0
Uniprot status: Unreviewed
Organism: Actinobaculum
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Actinobacteria ⇒ Actinomycetales ⇒ Actinomycetaceae ⇒ Actinobaculum.
Sequence Information back to top
Sequence length: 131
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|U1R6T0|U1R6T0_9ACTO|Unreviewed|Actinobaculum| 131
MAPRHTPDADSGDTAPASDQPAHVQESAHAQEADRPRTAYERRGGPVQQRAIRIIGPIAS
VMAIAMFVSYIPQIMNNLDGHKTNPLQPFVTMINCTLWTIYGLWRPKRDWPIAVANMPGI
LFGALAAVTGL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 56 Model end: 132 Inward Open: Template: 4X5M.pdb Model structure: U1R6T0_inward.pdb Alignment file: U1R6T0_inw.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 5.6% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: U1R6T0_outward.pdb Alignment file: U1R6T0_out.pir Procheck score ⇒ Ramachandran plot: 94.4% favored 3.2% allowed 2.4% week .0% disallowed Occluded: Model structure: U1R6T0_occluded.pdb Alignment file: U1R6T0_occ.pir Procheck score ⇒ Ramachandran plot: 92.7% favored 4.8% allowed 2.4% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA