Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U1N7H4

dbSWEET id: dbswt_1238

Accession:   U1N7H4

Uniprot status:   Unreviewed

Organism:   Ascaris suum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Ascaridida ⇒ Ascaridoidea ⇒ Ascarididae ⇒ Ascaris.

Sequence Information back to top


Sequence length:   230

Substrate Binding Site:   GSWN           CVV:   380       CHI:   -5.6

Selectivity Filter:   LSTV           CVV:   395       CHI:   6.5

Fasta sequence:

>tr|U1N7H4|U1N7H4_ASCSU|Unreviewed|Ascaris_suum|230
MHNADLQTDLIVRIVSSVAAVSTICLFLTGFEICWRIKKHGSTEDIGSAPFHMGFVSGFL
WLHYGILKEDRAVFCVNVVSSSLYTFYLLYYCLRTPYPMKRRQLRFAAIEIIFLSLIHLY
VEYSQHAKEIILDHLGYICVAFNVATVAAPLLALGEVIRSKSTENLPLPLCLANLLVTSE
WLLYGFLVEDFFIKFPNAIAVMISIAQIVPFAIYPRKGKISLSTKTSIRM

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   216

Alignment file: U1N7H4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  U1N7H4_inward.pdb

Procheck score ⇒ Ramachandran plot: 89.1% favored    9.4% allowed    .5% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  U1N7H4_outward.pdb

Procheck score ⇒ Ramachandran plot: 95.3% favored    3.6% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  U1N7H4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    5.7% allowed    2.1% week    1.0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur