Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : U1MRR4

dbSWEET id: dbswt_1237

Accession:   U1MRR4

Uniprot status:   Unreviewed

Organism:   Ascaris suum

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Nematoda ⇒ Chromadorea ⇒ Ascaridida ⇒ Ascaridoidea ⇒ Ascarididae ⇒ Ascaris.

Sequence Information back to top


Sequence length:   232

Substrate Binding Site:   SQIT           CVV:   350       CHI:   -6

Selectivity Filter:   LGSE           CVV:   344       CHI:   4.9

Fasta sequence:

>tr|U1MRR4|U1MRR4_ASCSU|Unreviewed|Ascaris_suum|232
MSNLVSHLIALYTANTAWSVFLTSTAVHAILLIASPVQAVCKWYRRQSSDGDTALPYVCA
CVGSSLWLRYSMFINDFKLILLQTYAVVMQLFFIIALLFYRSRKRSITRGLLSIVLLLLA
LFIYVEGLAYEDGKKLIGRFASGSQIAGSLVCPYLIHRAVKTKVIDFVPFAPVAFTWIME
MHAIIYSIAINDFYMLLANTTFFIMDGSLLAMFFIYPSERKTQPKLRSITVF

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   218

Alignment file: U1MRR4.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  U1MRR4_inward.pdb

Procheck score ⇒ Ramachandran plot: 91.1% favored    8.4% allowed    .0% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  U1MRR4_outward.pdb

Procheck score ⇒ Ramachandran plot: 94.2% favored    4.7% allowed    1.0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  U1MRR4_occluded.pdb

Procheck score ⇒ Ramachandran plot: 90.1% favored    7.9% allowed    1.6% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur