| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : T2M6F9
dbSWEET id: dbswt_1236
Accession: T2M6F9
Uniprot status: Unreviewed
Organism: Hydra vulgaris
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Cnidaria ⇒ Hydrozoa ⇒ Hydroidolina ⇒ Anthoathecata ⇒ Aplanulata ⇒ Hydridae ⇒ Hydra.
Sequence Information back to top
Sequence length: 224
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: YNMT CVV: 454 CHI: -3.6
Fasta sequence:
>tr|T2M6F9|T2M6F9_HYDVU|Unreviewed|Hydra_vulgaris|224
MVDISFFESEVFAVCVQGCALVLTIGYFLTGSITCMKIHHQKSVKNVNFLPYLTAFLNTF
LWFVYGSLKKDSLLIFVNSVGCILQAGYIFVFIQNCDKKQHYIKRVFTLGFTCFCVLVVA
EFGHIFFDTLLVLAWIACVVSVLMFGSPLSTVREVIRTKNAETISFPLSIMTCLTTISWF
IYGSLKHDNFVRFPNALGFILGLSQIYFINKFKNQKLLGTNLNV
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 6 Model end: 214
Alignment file: T2M6F9.pir
Inward Open:
Template: 5CTG.pdb
Model structure: T2M6F9_inward.pdb
Procheck score ⇒ Ramachandran plot: 90.0% favored 7.9% allowed 1.6% week .5% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: T2M6F9_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.1% favored 7.9% allowed .0% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: T2M6F9_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.5% favored 7.9% allowed 1.6% week 1.1% disallowed
Gene Informationback to top
Gene ID: 101235355 Total Exons: 6 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0005886 - plasma membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA