Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : T2M6F9

dbSWEET id: dbswt_1236

Accession:   T2M6F9

Uniprot status:   Unreviewed

Organism:   Hydra vulgaris

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Cnidaria ⇒ Hydrozoa ⇒ Hydroidolina ⇒ Anthoathecata ⇒ Aplanulata ⇒ Hydridae ⇒ Hydra.

Sequence Information back to top


Sequence length:   224

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   YNMT           CVV:   454       CHI:   -3.6

Fasta sequence:

>tr|T2M6F9|T2M6F9_HYDVU|Unreviewed|Hydra_vulgaris|224
MVDISFFESEVFAVCVQGCALVLTIGYFLTGSITCMKIHHQKSVKNVNFLPYLTAFLNTF
LWFVYGSLKKDSLLIFVNSVGCILQAGYIFVFIQNCDKKQHYIKRVFTLGFTCFCVLVVA
EFGHIFFDTLLVLAWIACVVSVLMFGSPLSTVREVIRTKNAETISFPLSIMTCLTTISWF
IYGSLKHDNFVRFPNALGFILGLSQIYFINKFKNQKLLGTNLNV

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   6     Model end:   214

Alignment file: T2M6F9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  T2M6F9_inward.pdb

Procheck score ⇒ Ramachandran plot: 90.0% favored    7.9% allowed    1.6% week    .5% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  T2M6F9_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.1% favored    7.9% allowed    .0% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  T2M6F9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.5% favored    7.9% allowed    1.6% week    1.1% disallowed

Gene Informationback to top


Gene ID:   101235355     Total Exons:   6     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur