| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : T1ZFS7
dbSWEET id: dbswt_1922
Accession: T1ZFS7
Uniprot status: Unreviewed
Organism: Streptococcus intermedius
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus ⇒ Streptococcus anginosus group.
Sequence Information back to top
Sequence length: 86
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|T1ZFS7|T1ZFS7_STRIT|Unreviewed|Streptococcus intermedius|86
MNEKRMKIIGWVATFMSVMMYVSYIPQIMDNLAGHKGNFIQPLVAAINCSLWVYYGLFKK
ERDLPLSAANAPGIVFGLITVLTAMF
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: T1ZFS7_inward.pdb Alignment file: T1ZFS7_inw.pir Procheck score ⇒ Ramachandran plot: 91.5% favored 8.5% allowed .0% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: T1ZFS7_outward.pdb Alignment file: T1ZFS7_out.pir Procheck score ⇒ Ramachandran plot: 93.1% favored 4.6% allowed .8% week 1.5% disallowed Occluded: Model structure: T1ZFS7_occluded.pdb Alignment file: T1ZFS7_occ.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 4.6% allowed .8% week .8% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA