Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : T1KZV9

dbSWEET id: dbswt_1234

Accession:   T1KZV9

Uniprot status:   Unreviewed

Organism:   Tetranychus urticae

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Chelicerata ⇒ Arachnida ⇒ Acari ⇒ Acariformes ⇒ Trombidiformes ⇒ Prostigmata ⇒ Eleutherengona ⇒ Raphignathae ⇒ Tetranychoidea ⇒ Tetranychidae ⇒ Tetranychus.

Sequence Information back to top


Sequence length:   218

Substrate Binding Site:   TSWN           CVV:   425       CHI:   -5.9

Selectivity Filter:   NCFV           CVV:   422       CHI:   6

Fasta sequence:

>tr|T1KZV9|T1KZV9_TETUR|Unreviewed|Tetranychus_urticae|218
MELIHVVSSLVIIFTFCNFTTGLQICIRIWKKKSTQDFAAFPFIAGFLCTFLGLRYGLVI
HDSVTIFVNSIGLAVFTFYVLFYYHFTLNKRSINLKIGVLIVVVLLFELAIGHQENPRTL
SGIIASISGVVFSGSPMTSISQVVRDKNAGILPFWLILSTAVVALLWFAYGFLIGDAFIQ
ISNSLAVLLAVFQLSLFVFYPPQSKYKDFEKQLLMENL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   202

Alignment file: T1KZV9.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  T1KZV9_inward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    6.6% allowed    1.1% week    .0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  T1KZV9_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.3% favored    7.1% allowed    .5% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  T1KZV9_occluded.pdb

Procheck score ⇒ Ramachandran plot: 92.9% favored    4.4% allowed    2.2% week    .5% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur