Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : T1JAX8

dbSWEET id: dbswt_1233

Accession:   T1JAX8

Uniprot status:   Unreviewed

Organism:   Strigamia maritima

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Myriapoda ⇒ Chilopoda ⇒ Pleurostigmophora ⇒ Geophilomorpha ⇒ Linotaeniidae ⇒ Strigamia.

Sequence Information back to top


Sequence length:   239

Substrate Binding Site:   CNWN           CVV:   441       CHI:   -5.4

Selectivity Filter:   LNFM           CVV:   479       CHI:   5

Fasta sequence:

>tr|T1JAX8|T1JAX8_STRMM|Unreviewed|Strigamia_maritima|239
MFLSDKYFESYVRLPHYDKKMGYSWNLNDFVELTATIATILTFFSGIGICLTIKRKRDTT
EVSAFPFLAGVINCSLWLKYGILQRDRTLMTVNSVGLFLQIIYAVFYYWYSSNKSYIKKM
FLVTALILFPILLYLKYFATDLIVATQTSGLVACCASIIFCASPLAGLAVVCKTKNAESL
PFTLILMTLVMSLLWFLYGVLHDDYFIQVPNVLGACLAAFQLFLFYIFPRHPTTKADTY

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   20     Model end:   230

Alignment file: T1JAX8.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  T1JAX8_inward.pdb

Procheck score ⇒ Ramachandran plot: 88.6% favored    7.8% allowed    2.6% week    1.0% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  T1JAX8_outward.pdb

Procheck score ⇒ Ramachandran plot: 86.5% favored    11.4% allowed    2.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  T1JAX8_occluded.pdb

Procheck score ⇒ Ramachandran plot: 87.6% favored    10.9% allowed    .5% week    1.0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0005886 - plasma membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur