Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : T1FVU1

dbSWEET id: dbswt_1232

Accession:   T1FVU1

Uniprot status:   Unreviewed

Organism:   Helobdella robusta

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Lophotrochozoa ⇒ Annelida ⇒ Clitellata ⇒ Hirudinida ⇒ Hirudinea ⇒ Rhynchobdellida ⇒ Glossiphoniidae ⇒ Helobdella.

Sequence Information back to top


Sequence length:   249

Substrate Binding Site:   TNWN           CVV:   448       CHI:   -8.6

Selectivity Filter:   LSVC           CVV:   388       CHI:   9.7

Fasta sequence:

>tr|T1FVU1|T1FVU1_HELRO|Unreviewed|Helobdella_robusta|249
MSFGFGELLENFTIGLTLILHLSGLSACQCMVRSKSTKGVPYLIFIFSTISCIIMIKYAC
ILEQPKLIFLNSVGLVLYVIYISLYLMYADNKAYDLAILGSLLAVPISLLFFTSGWISAN
NGGDKNGDGDASGKGDVLNVLGSALTINALFLISIPSIEVYHNLVNRNREGMPLVMIISG
LACFISWLAYGIMLNDIFIYLPNGIGMMVQALKLYAFVAFDDDGGDDVGEGGGGGGGGGG
RGGARKKKK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   1     Model end:   222

Alignment file: T1FVU1.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  T1FVU1_inward.pdb

Procheck score ⇒ Ramachandran plot: 86.0% favored    8.3% allowed    3.1% week    2.6% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  T1FVU1_outward.pdb

Procheck score ⇒ Ramachandran plot: 89.1% favored    7.3% allowed    3.6% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  T1FVU1_occluded.pdb

Procheck score ⇒ Ramachandran plot: 88.1% favored    8.3% allowed    1.6% week    2.1% disallowed

Gene Informationback to top


Gene ID:   20212937     Total Exons:   8     Coding Exons:   6

The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).

If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur