| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : T1FVU1
dbSWEET id: dbswt_1232
Accession: T1FVU1
Uniprot status: Unreviewed
Organism: Helobdella robusta
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Lophotrochozoa ⇒ Annelida ⇒ Clitellata ⇒ Hirudinida ⇒ Hirudinea ⇒ Rhynchobdellida ⇒ Glossiphoniidae ⇒ Helobdella.
Sequence Information back to top
Sequence length: 249
Substrate Binding Site: TNWN CVV: 448 CHI: -8.6
Selectivity Filter: LSVC CVV: 388 CHI: 9.7
Fasta sequence:
>tr|T1FVU1|T1FVU1_HELRO|Unreviewed|Helobdella_robusta|249
MSFGFGELLENFTIGLTLILHLSGLSACQCMVRSKSTKGVPYLIFIFSTISCIIMIKYAC
ILEQPKLIFLNSVGLVLYVIYISLYLMYADNKAYDLAILGSLLAVPISLLFFTSGWISAN
NGGDKNGDGDASGKGDVLNVLGSALTINALFLISIPSIEVYHNLVNRNREGMPLVMIISG
LACFISWLAYGIMLNDIFIYLPNGIGMMVQALKLYAFVAFDDDGGDDVGEGGGGGGGGGG
RGGARKKKK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 222
Alignment file: T1FVU1.pir
Inward Open:
Template: 5CTG.pdb
Model structure: T1FVU1_inward.pdb
Procheck score ⇒ Ramachandran plot: 86.0% favored 8.3% allowed 3.1% week 2.6% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: T1FVU1_outward.pdb
Procheck score ⇒ Ramachandran plot: 89.1% favored 7.3% allowed 3.6% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: T1FVU1_occluded.pdb
Procheck score ⇒ Ramachandran plot: 88.1% favored 8.3% allowed 1.6% week 2.1% disallowed
Gene Informationback to top
Gene ID: 20212937 Total Exons: 8 Coding Exons: 6
The diagram below shows the position of Exon-junctions in the protein structure ( Loops and transmembrane helices ).
If more than 1 exon translates a single secondary-structure , only the final exon is represented in figure.
Point on the red bars to view exon number






Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA