Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : T0XUI6

dbSWEET id: dbswt_1921

Accession:   T0XUI6

Uniprot status:   Unreviewed

Organism:   Leptospirillum

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Nitrospirae ⇒ Nitrospirales ⇒ Nitrospiraceae ⇒ Leptospirillum.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   AGAG           CVV:   230       CHI:   2.8

Fasta sequence:

>tr|T0XUI6|T0XUI6_9BACT|Unreviewed|Leptospirillum|88
MSLSIQTVNGIGIVAGTLTTLAFVPQAVQILRSRQTKNISLTMYVMSAMGVAIWIYYGLK
IESPPIIIFNGINLVLVMSILFAKLYWK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   9     Model end:   86

Inward Open:

Template:   4X5M.pdb

Model structure:  T0XUI6_inward.pdb    Alignment file: T0XUI6_inw.pir

Procheck score ⇒ Ramachandran plot: 93.2% favored    6.8% allowed    .0% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  T0XUI6_outward.pdb    Alignment file: T0XUI6_out.pir

Procheck score ⇒ Ramachandran plot: 95.5% favored    3.0% allowed    .0% week    1.5% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  T0XUI6_occluded.pdb    Alignment file: T0XUI6_occ.pir

Procheck score ⇒ Ramachandran plot: 97.0% favored    3.0% allowed    .0% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur