| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : T0TTW9
dbSWEET id: dbswt_1919
Accession: T0TTW9
Uniprot status: Unreviewed
Organism: Streptococcus
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Streptococcaceae ⇒ Streptococcus.
Sequence Information back to top
Sequence length: 110
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|T0TTW9|T0TTW9_9STRE|Unreviewed|Streptococcus| 110
MFTQHIVYYPLQNIDINILFYFVQKITKINQIVGSIGAFIGIIVFIAYIPQIFANLQGNK
AQPFQPLSAAVSCLIWVLYGWTNEPKKDWILIIPNSAGVILGGLTFLTSL
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 34 Model end: 111 Inward Open: Template: 4X5M.pdb Model structure: T0TTW9_inward.pdb Alignment file: T0TTW9_inw.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 6.3% allowed .8% week 1.6% disallowed Outward Open: Template: 4X5N.pdb Model structure: T0TTW9_outward.pdb Alignment file: T0TTW9_out.pir Procheck score ⇒ Ramachandran plot: 88.1% favored 10.3% allowed 1.6% week .0% disallowed Occluded: Model structure: T0TTW9_occluded.pdb Alignment file: T0TTW9_occ.pir Procheck score ⇒ Ramachandran plot: 91.3% favored 7.1% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA