| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : T0FHK3
dbSWEET id: dbswt_1917
Accession: T0FHK3
Uniprot status: Unreviewed
Organism: Leptospira noguchii
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 88
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|T0FHK3|T0FHK3_9LEPT|Unreviewed|Leptospira noguchii|88
MDSITFLGYIASLLTTISFLPQVIRILMGGSTKDISRNMYIVLVTGVFLWFIYGCLKQDF
PIILANAFTFLFAAAILYFKLRNDSKGK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: T0FHK3_inward.pdb Alignment file: T0FHK3_inw.pir Procheck score ⇒ Ramachandran plot: 93.4% favored 5.1% allowed 1.5% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: T0FHK3_outward.pdb Alignment file: T0FHK3_out.pir Procheck score ⇒ Ramachandran plot: 94.1% favored 5.1% allowed .0% week .7% disallowed Occluded: Model structure: T0FHK3_occluded.pdb Alignment file: T0FHK3_occ.pir Procheck score ⇒ Ramachandran plot: 96.3% favored 3.7% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA