Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : T0FHK3

dbSWEET id: dbswt_1917

Accession:   T0FHK3

Uniprot status:   Unreviewed

Organism:   Leptospira noguchii

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Spirochaetes ⇒ Leptospirales ⇒ Leptospiraceae ⇒ Leptospira.

Sequence Information back to top


Sequence length:   88

Substrate Binding Site:   VNVN           CVV:   402       CHI:   1.4

Selectivity Filter:   SGSG           CVV:   242       CHI:   -2.4

Fasta sequence:

>tr|T0FHK3|T0FHK3_9LEPT|Unreviewed|Leptospira noguchii|88
MDSITFLGYIASLLTTISFLPQVIRILMGGSTKDISRNMYIVLVTGVFLWFIYGCLKQDF
PIILANAFTFLFAAAILYFKLRNDSKGK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   82

Inward Open:

Template:   4X5M.pdb

Model structure:  T0FHK3_inward.pdb    Alignment file: T0FHK3_inw.pir

Procheck score ⇒ Ramachandran plot: 93.4% favored    5.1% allowed    1.5% week    .0% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  T0FHK3_outward.pdb    Alignment file: T0FHK3_out.pir

Procheck score ⇒ Ramachandran plot: 94.1% favored    5.1% allowed    .0% week    .7% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  T0FHK3_occluded.pdb    Alignment file: T0FHK3_occ.pir

Procheck score ⇒ Ramachandran plot: 96.3% favored    3.7% allowed    .0% week    .0% disallowed

Gene Informationback to top


Gene ID:   23203847

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur