Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : S8FBR0

dbSWEET id: dbswt_1915

Accession:   S8FBR0

Uniprot status:   Unreviewed

Organism:   Bacteroidetes bacterium

Kingdom:   Bacteria

Taxonomy back to top


Bacteria ⇒ Bacteroidetes.

Sequence Information back to top


Sequence length:   86

Substrate Binding Site:   CNCN           CVV:   364       CHI:   -2

Selectivity Filter:   SNSN           CVV:   338       CHI:   -8.6

Fasta sequence:

>tr|S8FBR0|S8FBR0_9BACT|Unreviewed|Bacteroidetes bacterium|86
MNQEKFLSILGWVATATAMAMYISYIPQIGSNLSGHKGDWLQPMVAGINCVLWVGYGFIR
KKKDWPIVIANFPGVVCGFLASITAL

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   11     Model end:   87

Inward Open:

Template:   4X5M.pdb

Model structure:  S8FBR0_inward.pdb    Alignment file: S8FBR0_inw.pir

Procheck score ⇒ Ramachandran plot: 83.1% favored    12.9% allowed    1.6% week    2.4% disallowed

Outward Open:

Template:   4X5N.pdb

Model structure:  S8FBR0_outward.pdb    Alignment file: S8FBR0_out.pir

Procheck score ⇒ Ramachandran plot: 83.9% favored    14.5% allowed    1.6% week    .0% disallowed

Occluded:

Template:   4QNC.pdb      4RNG.pdb

Model structure:  S8FBR0_occluded.pdb    Alignment file: S8FBR0_occ.pir

Procheck score ⇒ Ramachandran plot: 86.3% favored    11.3% allowed    1.6% week    .8% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR004316: SWEET_sugar_transpr. 

Panther:   NA

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur