| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : S8EIW4
dbSWEET id: dbswt_131
Accession: S8EIW4
Uniprot status: Unreviewed
Organism: Genlisea aurea
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Lentibulariaceae ⇒ Genlisea.
Sequence Information back to top
Sequence length: 219
Substrate Binding Site: ANWN CVV: 422 CHI: -6.1
Selectivity Filter: VSVS CVV: 356 CHI: 6.8
Fasta sequence:
>tr|S8EIW4|S8EIW4_9LAMI|Unreviewed|Genlisea_aurea|219
HHHIGLAFGILGNIISFFVYFSPMPTFWRIYKEKSTMEFDSLPYAVALFSAMLWMYYAFL
KPHSFLLITINSFGCVIQTFYLTLYFIYASRPARRQCLKILGIMNVGALGLILGVSYICF
EGHIRVQVVGWACVAVSVGVFAAPLRIVIHVVKTRSAEFMPFYLSFFLTLSAVMWFGYGI
FQHDLCIAIPNVVGFALGLVQMLLFLAYREAKTNEKEGK
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 1 Model end: 210
Alignment file: S8EIW4.pir
Inward Open:
Template: 5CTG.pdb
Model structure: S8EIW4_inward.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 6.5% allowed 1.1% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: S8EIW4_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.0% favored 3.8% allowed 1.1% week 1.1% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: S8EIW4_occluded.pdb
Procheck score ⇒ Ramachandran plot: 92.4% favored 6.5% allowed .0% week 1.1% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA