| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : S8E642
dbSWEET id: dbswt_665
Accession: S8E642
Uniprot status: Unreviewed
Organism: Genlisea aurea
Kingdom: Plantae
Taxonomy back to top
Eukaryota ⇒ Viridiplantae ⇒ Streptophyta ⇒ Embryophyta ⇒ Tracheophyta ⇒ Spermatophyta ⇒ Magnoliophyta ⇒ eudicotyledons ⇒ Gunneridae ⇒ Pentapetalae ⇒ asterids ⇒ lamiids ⇒ Lamiales ⇒ Lentibulariaceae ⇒ Genlisea.
Sequence Information back to top
Sequence length: 226
Substrate Binding Site: CNFN CVV: 413 CHI: -1.7
Selectivity Filter: LNMM CVV: 468 CHI: 4.1
Fasta sequence:
>tr|S8E642|S8E642_9LAMI|Unreviewed|Genlisea_aurea|226
ASVQSTCRDAAGVAGNIFAFGLFLSPTPTFRRIIRNESTEQFSGSPYIYALLNCLITAWY
GLPIISDHNLMVTTVNSIGALFQLVYLAIFINYADRSKKLKMLGLVFMVFVLFGIISFGS
LSMSDFGVRHLTVGFISCASLISMFASPLFIINLVIRTRSVEFMPFYLSLSTFLMSISFL
LYGVFNGDPFVYVPNGIGTILGTIQLLLFAYYRKPSQEDTTRPLII
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 1 Model end: 214
Alignment file: S8E642.pir
Inward Open:
Template: 5CTG.pdb
Model structure: S8E642_inward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.8% allowed .5% week .0% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: S8E642_outward.pdb
Procheck score ⇒ Ramachandran plot: 94.7% favored 4.3% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: S8E642_occluded.pdb
Procheck score ⇒ Ramachandran plot: 95.2% favored 3.7% allowed 1.1% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv.
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA