Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : S4P1Q5
dbSWEET id: dbswt_1231
Accession: S4P1Q5
Uniprot status: Unreviewed
Organism: Pararge aegeria
Kingdom: Metazoa
Taxonomy back to top
Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Lepidoptera ⇒ Glossata ⇒ Ditrysia ⇒ Papilionoidea ⇒ Nymphalidae ⇒ Satyrinae ⇒ Satyrini ⇒ Parargina ⇒ Pararge.
Sequence Information back to top
Sequence length: 228
Substrate Binding Site: SNWN CVV: 428 CHI: -8.7
Selectivity Filter: QMLV CVV: 467 CHI: 6.4
Fasta sequence:
>tr|S4P1Q5|S4P1Q5_9NEOP|Unreviewed|Pararge_aegeria|228
MEALSDILLPYKEPVSQVTRFVTIGQMFSGSFICYDIYKQGSTKGVGIMPFVGGLIMSIL
NLKFGFILRDDTMIQVNFMGLALNIIYLMIYYTYARNKGTVWMQMGLGGAFAAALIGYSE
MEDPKLVESRFGMIITVFMFYLIASPLFGLREIIRKQSTEGMPFPMILSGTVVTFMWFLY
GIILKNKFLVLQNVVVFSLCAFQLALFAIYPSKPKEAKKEKIKAKKTK
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 212
Alignment file: S4P1Q5.pir
Inward Open:
Template: 5CTG.pdb
Model structure: S4P1Q5_inward.pdb
Procheck score ⇒ Ramachandran plot: 86.0% favored 11.2% allowed 1.1% week 1.7% disallowed
Outward Open:
Template: 5CTG_outward.pdb
Model structure: S4P1Q5_outward.pdb
Procheck score ⇒ Ramachandran plot: 92.2% favored 6.7% allowed 1.1% week .0% disallowed
Occluded:
Template: 5CTG_occluded.pdb
Model structure: S4P1Q5_occluded.pdb
Procheck score ⇒ Ramachandran plot: 89.9% favored 8.4% allowed 1.7% week .0% disallowed
Gene Ontologyback to top
GO:0016021 - integral component of membrane
GO:0008643 - carbohydrate transport
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr.
Panther: PTHR10791:SF5