Details

Basic Information
Taxanomy
Sequence Information
Modeled Structures
Gene Information
Gene Ontology
Family Classification

Details : S4P1Q5

dbSWEET id: dbswt_1231

Accession:   S4P1Q5

Uniprot status:   Unreviewed

Organism:   Pararge aegeria

Kingdom:   Metazoa

Taxonomy back to top


Eukaryota ⇒ Metazoa ⇒ Ecdysozoa ⇒ Arthropoda ⇒ Hexapoda ⇒ Insecta ⇒ Pterygota ⇒ Neoptera ⇒ Endopterygota ⇒ Lepidoptera ⇒ Glossata ⇒ Ditrysia ⇒ Papilionoidea ⇒ Nymphalidae ⇒ Satyrinae ⇒ Satyrini ⇒ Parargina ⇒ Pararge.

Sequence Information back to top


Sequence length:   228

Substrate Binding Site:   SNWN           CVV:   428       CHI:   -8.7

Selectivity Filter:   QMLV           CVV:   467       CHI:   6.4

Fasta sequence:

>tr|S4P1Q5|S4P1Q5_9NEOP|Unreviewed|Pararge_aegeria|228
MEALSDILLPYKEPVSQVTRFVTIGQMFSGSFICYDIYKQGSTKGVGIMPFVGGLIMSIL
NLKFGFILRDDTMIQVNFMGLALNIIYLMIYYTYARNKGTVWMQMGLGGAFAAALIGYSE
MEDPKLVESRFGMIITVFMFYLIASPLFGLREIIRKQSTEGMPFPMILSGTVVTFMWFLY
GIILKNKFLVLQNVVVFSLCAFQLALFAIYPSKPKEAKKEKIKAKKTK

Snake diagram with key positions labelled



Modeled Structuresback to top


Model start:   5     Model end:   212

Alignment file: S4P1Q5.pir

Inward Open:

Template:   5CTG.pdb

Model structure:  S4P1Q5_inward.pdb

Procheck score ⇒ Ramachandran plot: 86.0% favored    11.2% allowed    1.1% week    1.7% disallowed

Outward Open:

Template:   5CTG_outward.pdb

Model structure:  S4P1Q5_outward.pdb

Procheck score ⇒ Ramachandran plot: 92.2% favored    6.7% allowed    1.1% week    .0% disallowed

Occluded:

Template:   5CTG_occluded.pdb

Model structure:  S4P1Q5_occluded.pdb

Procheck score ⇒ Ramachandran plot: 89.9% favored    8.4% allowed    1.7% week    .0% disallowed

Gene Informationback to top


Not Available

Gene Ontologyback to top


GO:0016021 - integral component of membrane

GO:0008643 - carbohydrate transport

Family Classificationback to top


Pfam:   PF03083: MtN3_slv 

Interpro:   IPR018178: SWEET_insect. IPR004316: SWEET_sugar_transpr. 

Panther:  PTHR10791:SF5

Bioinformatics and Biomolecular Simulation Laboratory, Department of Biological Sciences and Bioengineering, IIT Kanpur