Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : S4NJ70
dbSWEET id: dbswt_1914
Accession: S4NJ70
Uniprot status: Unreviewed
Organism: Lactobacillus otakiensis
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: ADAD CVV: 316 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|S4NJ70|S4NJ70_9LACO|Unreviewed|Lactobacillus otakiensis|85
MFSEEKVIGDIATVANMIMYISYIGEILQNLNGQPTSFIQPFCASINAALWVAYGWVKPK
RDWILIVADVPGVIFGLIAAVTAIM
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 9 Model end: 85 Inward Open: Template: 4X5M.pdb Model structure: S4NJ70_inward.pdb Alignment file: S4NJ70_inw.pir Procheck score ⇒ Ramachandran plot: 90.8% favored 6.9% allowed .8% week 1.5% disallowed Outward Open: Template: 4X5N.pdb Model structure: S4NJ70_outward.pdb Alignment file: S4NJ70_out.pir Procheck score ⇒ Ramachandran plot: 89.2% favored 9.2% allowed .8% week .8% disallowed Occluded: Model structure: S4NJ70_occluded.pdb Alignment file: S4NJ70_occ.pir Procheck score ⇒ Ramachandran plot: 92.3% favored 5.4% allowed .8% week 1.5% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA