Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : S3UYY7
dbSWEET id: dbswt_1912
Accession: S3UYY7
Uniprot status: Unreviewed
Organism: Leptospira fainei
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 87
Substrate Binding Site: VNVN CVV: 402 CHI: 1.4
Selectivity Filter: SGSG CVV: 242 CHI: -2.4
Fasta sequence:
>tr|S3UYY7|S3UYY7_9LEPT|Unreviewed|Leptospira fainei|87
MEPGSWIGYLASILTTISFVPQVVKVVLERKTRDISRNMYIVLSVGVGLWLAYGIIREDL
PIILANAFTLFLTTTILYFKLKEKEES
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 5 Model end: 82 Inward Open: Template: 4X5M.pdb Model structure: S3UYY7_inward.pdb Alignment file: S3UYY7_inw.pir Procheck score ⇒ Ramachandran plot: 94.2% favored 4.3% allowed 1.4% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: S3UYY7_outward.pdb Alignment file: S3UYY7_out.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 9.4% allowed .0% week .0% disallowed Occluded: Model structure: S3UYY7_occluded.pdb Alignment file: S3UYY7_occ.pir Procheck score ⇒ Ramachandran plot: 95.7% favored 4.3% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA