Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : S3KKS3
dbSWEET id: dbswt_1909
Accession: S3KKS3
Uniprot status: Unreviewed
Organism: Treponema socranskii
Kingdom: Bacteria
Sequence Information back to top
Sequence length: 85
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|S3KKS3|S3KKS3_TRESO|Unreviewed|Treponema socranskii|85
MSDKKLKILGWCGTVLSVTMYISYIPQIMGNLNGNKTPFIQPLAAAVNCTIWTLYGLLKE
KRDYPLAAANVPGIIFGLLATITAF
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 10 Model end: 86 Inward Open: Template: 4X5M.pdb Model structure: S3KKS3_inward.pdb Alignment file: S3KKS3_inw.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 7.1% allowed .0% week .8% disallowed Outward Open: Template: 4X5N.pdb Model structure: S3KKS3_outward.pdb Alignment file: S3KKS3_out.pir Procheck score ⇒ Ramachandran plot: 90.5% favored 7.9% allowed 1.6% week .0% disallowed Occluded: Model structure: S3KKS3_occluded.pdb Alignment file: S3KKS3_occ.pir Procheck score ⇒ Ramachandran plot: 92.1% favored 6.3% allowed 1.6% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA