Basic Information |
Taxanomy |
Sequence Information |
Modeled Structures |
Gene Information |
Gene Ontology |
Family Classification |
Details : S3BEP9
dbSWEET id: dbswt_1907
Accession: S3BEP9
Uniprot status: Unreviewed
Organism: Capnocytophaga
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Bacteroidetes ⇒ Flavobacteriia ⇒ Flavobacteriales ⇒ Flavobacteriaceae ⇒ Capnocytophaga.
Sequence Information back to top
Sequence length: 92
Substrate Binding Site: CNCN CVV: 364 CHI: -2
Selectivity Filter: ASAS CVV: 280 CHI: 2
Fasta sequence:
>tr|S3BEP9|S3BEP9_9FLAO|Unreviewed|Capnocytophaga|92
MNKKRNIKQKINLFIGSIGAFIGVMVFIAYIPQIIANLEGHKAQPWQPLFAAGSCLIWVV
YGWTKEPKPDYILIIPNFVGVVLGFLTFITSL
Snake diagram with key positions labelled
Modeled Structuresback to top
Model start: 16 Model end: 93 Inward Open: Template: 4X5M.pdb Model structure: S3BEP9_inward.pdb Alignment file: S3BEP9_inw.pir Procheck score ⇒ Ramachandran plot: 87.1% favored 12.1% allowed .8% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: S3BEP9_outward.pdb Alignment file: S3BEP9_out.pir Procheck score ⇒ Ramachandran plot: 90.3% favored 6.5% allowed .8% week 2.4% disallowed Occluded: Model structure: S3BEP9_occluded.pdb Alignment file: S3BEP9_occ.pir Procheck score ⇒ Ramachandran plot: 87.1% favored 11.3% allowed .0% week 1.6% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA