| Basic Information |
| Taxanomy |
| Sequence Information |
| Modeled Structures |
| Gene Information |
| Gene Ontology |
| Family Classification |
Details : S2SGR3
dbSWEET id: dbswt_1904
Accession: S2SGR3
Uniprot status: Unreviewed
Organism: Lactobacillus paracasei
Kingdom: Bacteria
Taxonomy back to top
Bacteria ⇒ Firmicutes ⇒ Bacilli ⇒ Lactobacillales ⇒ Lactobacillaceae ⇒ Lactobacillus.
Sequence Information back to top
Sequence length: 101
Substrate Binding Site: ANAN CVV: 326 CHI: -3.4
Selectivity Filter: SNSN CVV: 338 CHI: -8.6
Fasta sequence:
>tr|S2SGR3|S2SGR3_LACPA|Unreviewed|Lactobacillus paracasei| 101
MRVDTGKYPEGVDPVRVKRLKLLSKVATFTCILMYVSYIPEIIANFSGNPVNPIQPLVAM
INATLWTLYGWTKTYKDWPIIISNMPGILFGLVTFITVFIH
Snake diagram with key positions labelled

Modeled Structuresback to top
Model start: 24 Model end: 100 Inward Open: Template: 4X5M.pdb Model structure: S2SGR3_inward.pdb Alignment file: S2SGR3_inw.pir Procheck score ⇒ Ramachandran plot: 90.6% favored 7.0% allowed 2.3% week .0% disallowed Outward Open: Template: 4X5N.pdb Model structure: S2SGR3_outward.pdb Alignment file: S2SGR3_out.pir Procheck score ⇒ Ramachandran plot: 86.7% favored 9.4% allowed 1.6% week 2.3% disallowed Occluded: Model structure: S2SGR3_occluded.pdb Alignment file: S2SGR3_occ.pir Procheck score ⇒ Ramachandran plot: 93.8% favored 6.2% allowed .0% week .0% disallowed
Family Classificationback to top
Pfam: PF03083: MtN3_slv
Interpro: IPR004316: SWEET_sugar_transpr.
Panther: NA